Abstract
The intensity of muscle contraction, and therefore movement vigour, needs to be adaptable to enable complex motor behaviors. This can be achieved by adjusting the properties of motor neurons, which form the final common pathway for all motor output from the central nervous system. Here we identify novel roles for a neuropeptide, Cocaine and Amphetamine Regulated Transcript (CART), in the control of movement vigour. We reveal distinct, but parallel mechanisms by which CART and acetylcholine, both released at C bouton synapses on motor neurons, selectively amplify the output of subtypes of motor neurons that are recruited during intense movement. We find that mice with broad genetic deletion of CART or selective elimination of acetylcholine from C boutons exhibit deficits in behavioral tasks that require higher levels of motor output. Overall, these data uncover novel spinal modulatory mechanisms that control movement vigour to support movements that require a high degree of muscle force.
Introduction
The generation of complex motor behavior is critically dependent on the ability to precisely time the sequence of muscle activation and to regulate the amount of force produced by muscles. Whilst the timing of muscle activation is largely encoded by integrated populations of spinal interneurons 1,2, the strength of muscle activation, and subsequent movement vigour, is determined by motor neuron output. Importantly, motor neuron output is constantly adjusted to suit the task-dependent demands of diverse motor behaviors. These adjustments are often achieved by regulating cellular properties that determine motor neuron recruitment and firing rates 3–5. A range of neuromodulatory pathways, originating from higher centers and local interneurons, are responsible for this regulation of motor neuron properties. One of the most prominent spinally-derived neuromodulatory pathways for the regulation of motor output is mediated by spinal V0c interneurons and their C bouton synapses at motor neurons 6,7.
The broad V0 population of spinal interneurons, which are identified based on the expression of the Developing Brain Homeobox 1 transcription factor (Dbx1), were one of the first developmentally-defined populations shown to provide direct input to motor neurons 8. The V0 population, is composed of dorsal and ventral subpopulations 9,10. The ventral subpopulation includes a small subset that can be identified based on the expression of the Paired-like homeodomain transcription factor 2 (Pitx2), which is further subdivided into cholinergic (V0c) and glutamatergic (V0g) subsets 7. Although V0c interneurons comprise only 2.5% of the cardinal V0 population, they represent the sole source of large cholinergic C bouton synapses at the soma and proximal dendrites of motor neurons. V0c interneurons, and their C boutons, support the key function of increasing motor output during tasks of increased motor demand 7. Although significant knowledge exists regarding the pre- and post-synaptic machinery of the C bouton synapse, the mechanisms by which this system adjusts motor output remain to be fully resolved. The traditional view is that the release of acetylcholine from C boutons increases motor neuron firing rates through the activation of postsynaptic M2 muscarinic receptors leading to downstream effects on a range of ion channels including calcium-activated potassium channels and Kv2.1 channels 7,11.
Here, we reveal novel mechanisms by which V0c interneurons, and their C bouton synapses, regulate motor neuron activity. We show that a poorly understood signalling neuropeptide, the Cocaine and Amphetamine Regulated Transcript (CART), is expressed in V0c interneurons at all levels of the spinal cord and in most C boutons. Functional analysis reveals distinct, yet parallel mechanisms for CART and acetylcholine in the amplification of the output of a subset of motor neurons, fast motor neurons, that are typically only engaged during tasks that require high levels of motor output 12. We found that CART facilitates the recruitment of fast but not slow motor neurons, whereas cholinergic pathways increase firing rates of fast motor neurons. Intriguingly, neither CART nor acetylcholine are critical for the formation or maintenance of C bouton synapse structure, but they are important for the generation of motor behaviors that require high levels of motor output. Together, these findings support that CART represents a novel parallel signalling mechanism at this important neuromodulatory synapse. Given that cholinergic modulation of output neurons is a common feature of neural networks throughout the CNS13–15 our results are likely to be applicable to a range of networks and behaviors.
Results
Cocaine and Amphetamine Regulated Transcript is enriched in a subset of Pitx2 spinal interneurons
With the aim to identify markers to distinguish homogeneous, functionally-defined subsets of interneurons involved in motor control and locomotion we have previously performed a microarray screen 7 comparing the mRNA expression in the ventral and dorsal parts of the lumbar spinal cord of mice at postnatal day 8 (P8; Fig. 1a). We focused on genes that are preferentially expressed in the ventral, lumbar spinal cord where locomotor circuits reside 16. This screen resulted in the identification of 82 genes that were expressed more than three-fold higher in the ventral compared to the dorsal horn 7 two of which, Pitx2 and Short-stature homeobox 2 (Shox2), have been previously described and are expressed exclusively in subsets of spinal interneurons that play key roles in the control of motor neuron excitability and locomotor rhythm generation respectively 7,17. This study focuses on one of the genes highlighted by our screen, the Cart gene, one of the most enriched transcripts in the ventral spinal cord, which encodes a signaling peptide called the Cocaine and Amphetamine Regulated Transcript (CART) that following in situ hybridization was revealed to be expressed in a small interneuron subset in the intermediate zone of the spinal cord. CART was found to be expressed in a 3.4:1 ratio in the ventral compared to dorsal horn. Cart mRNA expression in P8 mice was detected in neurons located near the central canal, in the motor neuron area (Laminae VIII and IX), and the dorsal horn of the cervical (Fig. 1b), thoracic (Fig. 1c), and lumbar (Fig. 1d, e) segments of the spinal cord. In addition, Cart expressing neurons were also detected in the intermediate zone of the thoracic spinal cord, representing sympathetic preganglionic neurons (SPNs) (Supplementary Fig. 1a), consistent with previous reports 18–20. A similar expression profile was observed in the adult thoracic spinal cord (P25), where Cart mRNA was observed near the central canal, in the motor neuron-area, in putative SPNs, and in the dorsal horn (Fig. 1f).
We next performed immunohistochemistry experiments to examine the distribution of the CART peptide within the spinal cord. Consistent with in situ hybridization, CART-labelled somata were identified near the central canal, in the motor neuron area, in regions where SPNs reside, and in the dorsal horn of the P8 upper lumbar spinal cord (Fig. 1g). CART expressing neurons, as revealed by immunohistochemistry, recapitulated the in situ hybridization data in all spinal segments. Interestingly, we not only detected CART immunoreactivity in somata, but also in fibers in the superficial dorsal horn, Laminae VII-X, and through the anterior white commissure. A similar distribution of CART expression was also observed in spinal cords obtained from mice at P0 suggesting that CART expression is also present at birth, albeit with a lower intensity in the superficial dorsal horn (Fig. 1h).
We next set out to determine the identity of CART expressing neurons found near the central canal. Our attention was drawn to clusters of CART+ neurons located lateral to the central canal, that appear at all spinal levels, and were reminiscent of the V0cg (Pitx2+) subsets of interneurons. As shown in 7 the Pitx2 transcription factor defines two small interneuron subsets of the V0 population, the cholinergic V0c and the glutamatergic V0g, located in clusters close to the central canal and forming columns running throughout the rostrocaudal axis. The cholinergic V0c subset is known to be the sole source of cholinergic C bouton synapses on the somata and proximal dendrites of motor neurons. Therefore, should Pitx2 and CART expression co-localize a new marker and more importantly a potential neurotransmitter for the V0cg interneurons may be at hand.
To test this hypothesis, we crossed a Pitx2::Cre 21 mouse line with a Rosa.lsl.tdTomato 22 reporter line to express the fluorescent protein tdTomato in the tissues after excision of the LoxP-flanked stop cassette by Cre recombinase. CART was expressed in a subset of tdTomato-expressing somata (83%) (Fig. 1i,j), suggesting the CART peptide may only be expressed in a subset of the Pitx2+ interneurons. Surprisingly, 98% of V0c interneurons, co-labelled with Choline Acetyl Transferase (ChAT) and tdTomato, were CART+, specifically 97% in cervical, 98% in thoracic and 100% in upper lumbar levels (Fig. 1k). On the other hand, CART was only found in 65% of tdTomato+ ChAT-V0g interneurons; 65% in the cervical, 71% in thoracic and 61% in lumbar segments.
Diverse expression profiles of CART within C bouton synapses
V0c interneurons give rise to large cholinergic synapses called C boutons that are located on the somata and proximal dendrites of alpha motor neurons and are important for facilitating output during tasks that require greater motor output 7,11. We therefore next examined CART expression at C boutons to determine if CART might be a novel signaling peptide at this synapse. Immunohistochemistry for CART demonstrated a high density of CART+ puncta in lamina VIII and IX. We also detected some CART+ motor neuron somata (ChAT+), as previously detected in the in situ hybridization experiments (Fig. 2a, Supplementary Fig. 2a, b). Focusing on lamina IX, the CART+ puncta were found to colocalize with ChAT+ terminals on motor neurons of P8 (Fig. 2b) and P25 mice (Fig. 2c), suggesting that CART may serve as a second neurotransmitter at C bouton synapses (Fig. 2d).
Colocalization of CART and ChAT in C bouton synapses (Fig. 3a), and in some motor neuron somata (Fig. 3b) was further supported by additional experiments in spinal cord sections from Pitx2::Cre;Rosa.lsl.tdTomato mice, where C bouton synapses were visualized with tdTomato. Using the IMARIS Image Analysis software (Oxford Instruments) on deconvolved confocal images, two different 3D surfaces were created that outline the volumes of interest (tdTomato: red surface, CART: green surface) revealing the partial or complete enclosure of the CART surfaces in the synapse (Fig. 3c, Supplementary Fig. 3). Further observations of CART immunoreactivity patterns at C bouton synapses revealed a heterogenous distribution of CART within the presynaptic terminal. Synapses from spinal cords of Pitx2::Cre;Rosa.lsl.tdTomato mice and wild type mice (n=3 for each genotype, 400-700 synapses/mouse); labelled with anti-vesicular acetylcholine transporter (vAChT) and anti-CART antibodies were examined. Both approaches revealed four discrete distribution patterns of the CART neuropeptide in C bouton synapses (Fig. 3d). These included: i) “compact” synapses with an interior almost completely filled with the CART neuropeptide; ii) synapses with “puncta along the synapse” that had 3 or more CART+ puncta along the length of the synapse; iii) synapses with 1-3 puncta; and iv) also synapses with “peripheral puncta” that exhibited CART+ puncta at both ends of the synapse. Finally, we also observed cholinergic synapses that were devoid of the CART peptide. All CART distribution patterns were observed across postnatal development and through adulthood of mice (p10, p25, 8-9 weeks old, six months old, one year old; Fig. 3e), suggesting that this diversity is a general feature of CART at C bouton synapses.
Parallel amplification of motor neuron output by CART and acetylcholine
We next sought to investigate whether CART provides an additional, physiologically relevant signalling mechanism at C bouton synapses. Given that C boutons are potent modulators of motor neuron excitability 11,23, we assessed whether CART could modulate the excitability of spinal motor neurons. We also compared any effects of CART with those of muscarine, which activates the predominant, known acetylcholine-based signaling mechanisms at C bouton synapses. We examined the effect of CART and muscarine on motor neuron recruitment and firing rate, which are two key mechanisms for the gradation of muscle force.
Previous work has reported higher densities of C boutons on fast compared to slow type motor neurons 24, in addition to differences in the postsynaptic structures located at C bouton synapses that contact different types of motor neurons 25,26. We therefore investigated whether CART or acetylcholine mediated modulation of the intrinsic properties that shape the recruitment or firing rate of motor neurons varied for fast versus slow type motor neurons from animals age P7-12. Motor neuron subtypes were identified based on their repetitive firing profiles 27,28 with fast motor neurons identified by a delayed firing and accelerating firing rate (Fig. 4a; n=21) and slow motor neurons identified by an immediate onset of repetitive firing and steady or adapting firing rates (Fig. 4b; n = 16). Consistent with these two populations representing fast and slow motor neuron types, and in line with previous work 27,28 delayed firing motor neurons had a lower input resistance (Fig. 4c; t(33)= 4.7, p = 4.3e-5) and a higher rheobase (Fig. 4c; t(34)=4.96, p = 2.1e-5), along with other differentiating intrinsic properties (summarized in Supplementary Fig. 4).
Having confirmed techniques to physiologically distinguish fast versus slow-type motor neurons, we next investigated the effects of CART (1 μM) or muscarine (10 μM) on the intrinsic properties of these motor neuron subtypes. Interestingly, both CART and muscarine selectively modulated several intrinsic properties in fast motor neurons only. Specifically, CART hyperpolarized the resting membrane potential (Fig. 4d, e, f; F (1.6,29) = 19.7, p = 2.2e-5), increased the input resistance (Fig. 4g; F (1.6, 30.6) = 7.6, p = 0.003), which translated to a reduction in the recruitment current (Fig. 4h, j; F (1.6, 30.6) = 3.5, p = 0.05), in fast but not slow type motor neurons (Fig. 4i, j). The decrease in recruitment current of the largest fast motor neurons led to an increase in the recruitment gain across the motor pool (Fig. 4k). Consistent with previous reports 23,29, we found that muscarine had a range of effects on motor neuron intrinsic properties. However, these effects were most robust in fast type motor neurons (n= 12), with no significant changes in the slow type motor neurons (n=7). In the fast motor neurons, muscarine depolarized the resting membrane potential (Fig. 4d, e, f; F (1.7,15.3) = 13.9, p = 5.4e-4), but did not change input resistance (Fig. 4g) or recruitment current of either fast or slow type motor neurons (Fig. 4l-o).
Both CART and muscarine also produced complementary modulation of fast but not slow motor neuron firing rates, assessed during slow depolarizing current ramps. CART increased firing rates at the lower end of the frequency current range (minimum firing rate: Fig. 5a, c; F (1.9,31.2) = 6.6, p = 0.005) and firing rate at 2x recruitment: Fig. 5d; F (1.8,29.7) = 3.4, p = 0.04), with no change in maximal firing rate (Fig. 5e; F (1.8,29.8) = 1.2, p = 0.3) in fast but not slow motor neurons (Fig. 5b, c-e). In contrast to CART, muscarine did not change the firing rate at recruitment (Fig. 5a, c; F (1.3,12.7) = 1.8, p = 0.2), but did increase the firing rate at 2x rheobase (Fig. 5d; F (1.4,13.2) = 9.2, p = 0.006) and the maximal firing rate (Fig. 5e; F (0.9,7.8) = 7.6, p = 0.03) in fast but not slow motor neurons (Fig. 5b, c-e). Both action potential rise time and half width were unaltered by CART or muscarine (Supplementary Tables 1, 2). CART and muscarine produced opposing control of the medium afterhyperpolarization (mAHP). CART increased the amplitude (Fig. 5f, h; F (1.2, 20.4) = 12.9, p = 0.001) and half width (Fig. 5k; F (1.6, 27.1) = 5.3, p = 0.02) of the mAHP of fast but not slow motor neurons (Fig. 5g, h, k). Muscarine reduced the mAHP amplitude (Fig. 5i, h; F (1.6,13.7) = 19.7, p = 2.3e-4) and half width (Fig. 5k; F (1.6,13.7 = 10.7, p = 0.002) in fast motor but not slow motor neurons (Fig. 5j, h, k).
Together, these data indicate that CART indeed affects motor neuron excitability. The two neurotransmitters, CART and acetylcholine, increase motor output through differential control of motor neuron subtypes via two key mechanisms that are important for the gradation of muscle force, with CART increasing recruitment and firing rates at the lower end of the input range and acetylcholine increasing firing rates throughout much of the input range without affecting recruitment or firing rate at recruitment.
CART and acetylcholine are not essential for the formation and maintenance of C bouton structure
Having identified CART as a novel signaling molecule that is present alongside acetylcholine at C bouton synapses, we next set out to determine the relative importance of the two signaling pathways and what roles, if any, they may play in supporting the structural integrity of C bouton synapses. To address this, we studied C bouton synapses in P25 mice, identified with antibodies against vAChT and ChAT, when CART was globally knocked out 30 or ChAT conditionally deleted from V0c interneurons and their efferent C boutons (Dbx1::Cre;ChATfl/fl),31–33(Fig. 6a-f). As expected, we detected no immunoreactivity for the CART peptide in CARTKO/KO mice (Fig. 6c). Strikingly, despite the absence of CART, C bouton synapses on motor neuron somata (ChAT+) remained well formed and appeared morphologically unaltered as confirmed by both ChAT and vAChT immunoreactivity (Fig. 6c). This result suggests that despite the complete absence of CART peptide, C bouton terminals remain structurally intact and develop in a manner consistent with control mice (Fig. 6a). The assessment of the conditional elimination of the ChAT gene from V0c interneurons yielded similar results (Fig. 6e). Despite the absence of the ChAT enzyme, CART peptide was still detected in C bouton synapses as revealed by vAChT labelling, suggesting that C bouton gross anatomy remains intact, and that CART peptide expression is unaltered and independent of the presence of acetylcholine (Fig. 6e; Schematic representations Fig. 6b, d, f).
We next considered the possibility that CART and acetylcholine may serve parallel roles in supporting C bouton synapses, such that deletion of one could support synapse integrity in the absence of the other. We therefore examined C boutons in double knockout mice (KO), with both global knockout of CART and V0c-selective deletion of ChAT (Dbx1::Cre;ChATfl/fl;CARTKO/KO, double KO; Supplementary Fig. 5a-f). However, examination of the C bouton synapses on the somata of motor neurons of double KO mice using the cholinergic marker vAChT, revealed that the C boutons remain detectable despite the absence of ChAT and CART (Fig. 6g-j). No difference was observed in the number of vAChT+ C boutons in double KO mice compared to WT (Mann-Whitney U = 1867, p = 0.6730 two-tailed; Fig. 6o; Supplementary Table 3) nor in the size of vAChT+ terminals (Mann-Whitney U = 25733, p = 0.0666 two tailed; Supplementary Table 4).
We also considered the possibility that deletion of CART and ChAT could influence the clustering of the key receptor expressed on the postsynaptic membrane at C bouton synapses. We therefore examined the postsynaptic M2 receptors (Fig. 6k-n). We found no difference in either the total number of M2 receptor clusters on motor neuron somata (Mann-Whitney U = 1001, p = 0.4402 two-tailed; Fig. 6p; ST1) nor in the size of M2 receptor clusters (Mann-Whitney U = 25658, p = 0.0537 two tailed; ST2). The number of M2 receptor clusters aligned with vAChT+ boutons also remained unaltered in double knockout mice compared to wildtype controls (Mann-Whitney U = 963, p = 0.2880 two-tailed; Fig. 6q; ST1). Together, these data suggest that neither CART nor acetylcholine are essential for the maintenance of the pre and postsynaptic structure of C boutons, given that we find no change in C bouton number, gross synapse morphology and size, or postsynaptic organization and M2 cluster size in double knockout mice with V0c specific deletion of ChAT and global CART knockout.
CART and acetylcholine are critical signalling molecules for vigorous motor behaviors
Given that CART is expressed at C boutons and provides amplification of motor neuron output in parallel with acetylcholine mediated signaling, we next set out to determine whether perturbing CART or acetylcholine signaling at C boutons could influence motor behaviors that require greater levels of strength and muscle coordination. We deployed a hanging wire test, which requires mice to recruit multiple muscle groups of the torso and limbs, providing a useful tool to evaluate possible impairments in high muscle force, exertion, and coordination. In this task, mice are positioned on an elevated wire from which they hang with all four limbs. The number of times that animals reached the end of the hanging wire, during a three-minute period, was counted as an indirect measure of muscle strength and endurance 34–36. Motor performance on this task was assessed in mice with global CART knockout, C bouton-specific deletion of ChAT, or both manipulations in tandem (double KO).
Adult mice that had ChAT deleted from C boutons (Dbx1::Cre;ChATfl/fl, n = 22, mean ±SEM = 4.59 ± 0.65) exhibited a significant decrease in the number of times they reached the end of the wire compared to control mice (ChAT fl/fl mice, n = 23, mean ±SEM = 7.09 ± 0.90; t (43) = -2.28, p = 0.031). This result indicates that motor performance related to strength is diminished when mice have the ChAT gene exclusively eliminated in V0c interneurons (Fig. 7a). Consistent with animals that had ChAT eliminated from C boutons (Dbx1::Cre;ChATfl/fl), CART knock out mice (CARTKO/KO, n =17, mean ±SEM = 5.76 ± 0.70) also reached the end of the wire significantly fewer times compared to wild type control mice, (n= 11, mean ±SEM = 9.27 ± 1.04, t (26) = -2.89, p = 0.008); however, this effect was specific to males only (Fig. 7b). The female CART KO mice (n = 16, mean ±SEM = 9.94 ± 1.56) did not differ significantly in the number of reaches from their wild type counterparts, (n = 11, mean ±SEM = 7.55 ± 1.57, t (25) = 1.04, p = 0.307; Fig. 7c). A similar, significant decrease in the number of times the end of the wire was reached was found in male mice lacking both CART globally and ChAT exclusively from V0c interneurons (Dbx1::Cre;ChATfl/fl;CARTKO/KO, n = 21, mean ±SEM = 3.9 ± 0.50) compared to control mice (n = 28, mean ±SEM = 5.68 ± 0.57, t (47) = -2.25, p = 0.029) (Fig.7d) suggesting a sex-specific motor deficit for this particular genotype. The female counterparts (Dbx1::Cre;ChATfl/fl;CARTKO/KO, n = 15, mean ±SEM = 6.33 ± 0.98) did not differ significantly compared to control mice (n = 25, mean ±SEM = 6.16 ± 0.58, t (38) = 0.163, p = 0.872), Fig. 7e, f).
Together these results indicate that CART and acetylcholine exhibit parallel roles in the control of motor behavior, with a particular role for CART in male mice.
Discussion
Spinal circuits composed of distributed populations of interneurons support a diverse array of functions including the control of movement. Much of what we have learned about roles for spinal interneurons for the control of movement has been derived from the study of locomotor movements that can be broken into properties related to the rhythm and pattern 2,37,38. However, complex behaviors are critically dependent on the ability to fine tune the degree of precision and vigour of the underlying movements.
Our previous work identified a subset of spinal cholinergic interneurons, called V0c interneurons that are defined by the expression of the transcription factor Pitx2, and constitute the sole source of C bouton synapses on motor neurons. The C bouton synapse is believed to be an important neuromodulatory synapse that task-dependently increases motor output in mammals 7,11. Pre-synaptic components of C boutons (V0c terminals) include cholinergic markers ChAT and vAChT, 39,40 along with Synaptobrevin (Vamp2) 41, ErbB2/4 receptors 42, P2X7R purinergic receptors43, and possibly Nicotinic Acetylcholine Receptors (NAchR) 44. The post-synaptic membrane aligned with C bouton terminals houses N-type calcium channels 45, Ca2+-dependent-K+ channels (SK2/3) 25, calcium-activated chloride channels 26 and ErbB3/4 receptors 46. In the Subsurface Cisterns (SSCs) of C boutons, Sigma-1 receptors 47, indole-N-methyl transferase (INMT) 47 and Neuregulin 1 (NRG1) 48 have been identified (Fig. 2d). The wide range of proteins localized to pre- and post-synaptic regions of C boutons points towards a particularly complicated multicomponent synapse. Here, we have demonstrated further complexity to this synapse, by revealing a novel neuropeptide, encoded by the cocaine and amphetamine regulated transcript (CART) in V0c interneurons at all levels of the spinal cord and in the vast majority of the cholinergic C bouton synapses on motor neurons. These initial anatomical data led us to investigate whether CART may provide a novel complementary signalling mechanism at this important neuromodulatory synapse.
CART was first described in the rat striatum as a hyper-expressed mRNA after cocaine and amphetamine administration 49. Since then, CART has been detected throughout the CNS and has been linked to multiple functions, such as olfaction and vision 19,50 pain processing 19,51,52, addictive behavior 53,54, regulation of appetite and body weight 30,55,56 as well as stress responses and anxiety 57–59. In the spinal cord CART has been previously traced in fibers in laminae I and II of the dorsal horn, in some somata in laminae X and VII, and in sympathetic preganglionic neurons 19,20,60.
The fact that we detected CART in synapses on motor neurons raised the question of its involvement in motor control. Knockout of CART exerted functional consequences and led to a poorer performance on the hanging wire test, a motor task that requires increased muscle strength and endurance, pointing to an important role in motor control (Fig. 7). Surprisingly, this deficit was only observed in males. This finding is perhaps not entirely unexpected, given that sex differences regarding CART expression during a stressful motor demanding task have been previously observed 61. Also, male specific changes of the C bouton synapse have been observed in disease62,63. Although there are currently limited tools (conditional knock out mice, agonists, antagonists) available to study CART’s specific role in motor control, it is possible that this behavioral deficit might be due to the loss of CART in other areas of the CNS. However, our in vitro electrophysiological analyses provided evidence that CART influences spinal circuits. Here, we show that CART and acetylcholine, provide differential control of motor neuron subtypes that innervate different muscle fibers; with a bias toward motor neuron subtypes that innervate high force generating, fast twitch muscle fibers that are generally recruited during tasks that require increased levels of muscle force (Fig. 8a-d). Interestingly, CART and acetylcholine accomplish this control through distinct, yet parallel physiological mechanisms for the gradation of muscle force with CART decreasing the recruitment current and acetylcholine agonist muscarine increasing firing rates across much of the frequency current range.
We can now correlate these single cell mechanisms to changes in animal behavior, since we observed that lack of CART in male mice leads to poorer motor performance. It remains to be determined whether peptidergic co-transmission involving CART is a common feature of other cholinergic modulatory systems that regulate the output neurons of a range of neural networks 13–15.
The post-synaptic receptors and target ion channels that mediate CART and acetylcholine’s differential control of motor neuron subtypes are not yet known. However, differences in ion channels that control the recruitment and firing rates of fast and slow motor neurons are beginning to be described and could contribute to their differential modulation 25,28. Further, recent evidence points to greater C bouton innervation of motor neurons that innervate fast compared to slow twitch muscles; a difference that is most pronounced in male mice63, and is in line with behavioral deficits that we observe in CART knockout animals. Regarding CART receptors, recent studies have pinpointed the G-Protein-Coupled-Receptor (GPCR) Gpr160 as a putative receptor for the CART peptide, proposing that CARTp/Gpr160 signaling in the dorsal horn of the spinal cord mediates neuropathic pain through a c-fos and ERK/CREB pathway 64. Furthermore, CARTp/Gpr160 coupling in the rat brainstem has been proven necessary for the anorexigenic and antidipsogenic effects of exogenous CART administration 65. The identification of the CART peptide receptor in the ventral horn and in particular in the motor neuron membrane remains to be determined; however, its discovery will have the potential to reveal the intracellular signaling mechanisms initiated by CART-motor neuron communication.
C bouton source neurons (Pitx2+ and CART+), the V0c interneurons, were traditionally believed to increase motor output by releasing acetylcholine that acts on M2 muscarinic receptors. Given that chemogenetic activation of V0c interneurons produced only a subset of the effects exerted by global pharmacological activation of muscarinic receptors 11, it has been suggested that C boutons produce a distinct set of cholinergic modulatory actions on motor output, with other effects produced by additional, as yet undefined, cholinergic inputs. However, here we show that CART replicates a subset of the effects of chemogenetic activation of V0c interneurons that are not elicited through pharmacological activation of muscarinic receptors, which includes decreased rheobase, increased input resistance, and increased mAHP amplitude. This result suggests that the CART and acetylcholine may provide co-modulation of motor neurons at C boutons synapses. The diversity in modulatory actions between studies could be accounted for by distinct control of fast and slow motor neuron subtypes, which is only beginning to be studied. The diversity in CART function, apart from the recipient motor neuron, is also reflected in the diverse CART expression profiles at C bouton synapses, which were previously believed to be a homogenous synapse. CART is found in most C boutons in different patterns, all of which could be observed throughout the animals’ lifespan (Fig. 3e). In line with our observations, diversity in synapse nanostructure, arising from different inputs, has been reported to also change in ventral versus dorsal areas, during development and through adulthood 66. Further, V0c interneuron diversity can also be accounted for by ipsilaterally and bilaterally projecting populations 67. C bouton diversity is further supported by the demonstration that V0c interneurons subdivide into connexin36 positive and negative subpopulations 68. The gap junction protein is also differentially distributed in C boutons, with fast motor neurons having a greater abundance of connexin 36 positive terminals than slow motor neurons. Thus, even within a small subset of functionally defined spinal interneurons, the V0c subset, we find that there is marked diversity with respect to their anatomy and function depending on source neurons, target motor neuron subtypes, but also sex. This highlights perhaps unexpected but marked diversity in a prominent neuromodulatory synapse, the C bouton synapse, that was once believed to be homogeneous.
The diversity of synaptic components in C bouton synapses, in conjunction with our findings of their functional role, reveal a highly complex and specified component of the motor circuit with a well-defined purpose. Strikingly, we find that the establishment of the V0c-motor neuron synaptic contacts, which are regulated by signals during development, seems to be oblivious of the neurotransmitter content of the C boutons, since the genetic elimination of CART, acetylcholine, or both, did not seem to affect the presence or alter the anatomy of the C bouton synapse nor of its pre and postsynaptic components. This finding lays the ground for the investigation of the wiring of interneuronal motor circuits during development and the elucidation of the importance of functional output for target selection and structural stability of synapses during ontogeny.
In conclusion, we have identified CART neuropeptide together with acetylcholine in the C bouton synapse on motor neurons and proposed a novel role for CART at these synapses, which is important for the neural control of movement. CART facilitates recruitment and firing rates at the lower end of the input range of fast type motor neurons, while acetylcholine augments maximal firing rates throughout most of the input range of fast type motor neurons. Thus, differential neuromodulatory control via acetylcholine and CART may serve as a means to more effectively fine tune muscle activation and force generation. This novel mechanism for adjusting the gain of motor output may be applicable to cholinergic modulatory systems throughout the CNS.
Methods
Differential expression screen and in situ hybridization
The differential mRNA expression screen was performed as described in7. Briefly upper lumbar (L1-L3) spinal cord segments from P8 mice were isolated and mounted in 2% agarose. The embedded segments were sectioned (Leica VT1000 S Vibrating blade microtome, 200-250μm) and each section was dissected. The intermediate zone was discarded. Dorsal and ventral parts were collected after white matter removal (Fig. 1a). RNA was isolated (n = 3 or 4 mice per sample) using the RNeasy Mini Kit (QIAGEN), and aRNA was synthesized with Ambion’s MessageAmp aRNA Kit (Catalog # 1750) using Biotin 11-CTP and Biotin 16-UTP (Enzo). Affymetrix Gene chip Mouse Genome 430 2.0 Arrays were hybridized. Gene Traffic software was used for data analysis. The in situ hybridization experiments for the detection of CART and Pitx2 mRNA expression in spinal cord cross sections (Leica CM3050 S cryostat) were performed as described in 69.
Tissue preparation and immunohistochemistry
Spinal cords were isolated by anesthetizing animals with intraperitoneal injections (15μL/g body weight) of ketamine (10mg/mL) and xylazine (2 mg/mL) prior to performing transcardial perfusion with cold 4% paraformaldehyde (PFA) in PBS (the perfusion was omitted in P0 mice). Spinal cords were isolated and post-fixed in 4% PFA (2h), then washed in PBS (4 times) and cryoprotected in a 30% sucrose solution under slight rocking (4°C) overnight. Spinal cords were further dissected (cervical, thoracic, upper lumbar and lower lumbar segments separation), and embedded in Tissue-Tek OCT medium. The immunohistochemistry experiments were performed in 15-20μm cryostat sections that were collected with positively charged or polylysine covered slides and stored at -80°C after drying in RT. The sections were washed with PBS and were incubated with a 1% BSA-0,1%Triton-X-100 in PBS solution containing the primary antibodies inside a humidified chamber at 4°C overnight. Next the sections were incubated with fluorescently labeled secondary antibodies for 2h, were washed with PBS (4 times for 5 minutes) and covered in Vectashield mounting medium.
Antibodies used: Rabbit anti CART (Phoenix Pharmaceuticals, G003-62), rabbit anti ChAT (Jessell lab, CU1574), rabbit anti vAChT (Jessell lab, CU1475), rabbit anti Pitx2 (Jessell lab, CU1533), rabbit anti M2 (Alomone labs, AB9452), guinea-pig anti vAChT (Fitzerald, 20R-VP002), goat anti vAChT (Millipore, ABN100), goat anti ChAT (Millipore, AB144P).
Mouse Lines
For all the experiments both male and female animals were utilized. No differences were observed in the anatomy experiments so data were pooled. In the behavioral experiments sex-dependent differences were observed and data were analysed separately. The following mouse lines were used: Pitx2::Cre 21, Rosa.stop.tdTomato 22, Dbx1::Cre 31, ChAT fl/fl 32,33, CARTKO/KO 30. All genotypes mentioned in this manuscript were a result of elaborate selective breeding of the aforementioned mouse lines. Mice 4-6 months old were used for the behavioral experiments. The use of the specific CARTKO/KO mouse line 30 allowed us to perform the motor performance test coherently as the weight gain caused by the complete knockout of the CART gene was detectable only after 40 weeks of age. Anatomy and behavioral experiments were performed in the animal facility of the Center for Clinical, Experimental Surgery and Translational Research of the Biomedical Research Foundation of the Academy of Athens. The facility is registered as “breeding” and “user” establishment by the Veterinary Service of the Prefecture of Athens according to the Presidential Decree 56/2013 in harmonization to the European Directive 63/2010 for the protection of animals used for scientific purposes. User establishment is also ISO 9001:2015 accredited. All animals of the facility were regularly screened using a health monitoring program, in accordance to the Federation of European Laboratory Animal Science Associations’ recommendations.
Statistical analysis of anatomy data
A total of n=3, Dbx1::Cre;ChATfl/fl;CARTKO/KO (experimental) and n=4 control mice were used for the synaptic counts. The vAChT+ terminals, postsynaptic M2 receptors and their close apposition were counted form single confocal images that translate to a physical section thickness of 1,208 μm (optical section), using Fiji 70. The normality of the distribution of counts within the experimental and control groups was assessed using the Shapiro-Wilk test and the non-parametric Mann-Whitney U test was used to compare group ranks (GraphPad Prism version 9.0.0 for Windows, GraphPad Software, San Diego, California USA, www.graphpad.com). The bar-charts representing the mean number of synapses per motor neuron section with the superimposed data points, representing data distribution, were also designed with GraphPad Prism 9.0.0. The median value is also presented as a red dot superimposed in each graph. Similarly, n=3, Dbx1::Cre;ChATfl/fl;CARTKO/KO (experimental) and n = 3 control mice were used to evaluate the size of vAChT+ terminals and M2 postsynaptic clusters. In control animals 250 synapses were examined and tested against 228 synapses from experimental animals, using the Mann-Whitney U-test. The same procedure was followed for the 254 control and 225 experimental synapses evaluated for the size of M2 clusters. Data are presented as mean values (±SEM) and were combined as no sex-dependent differences where observed. Statistical significance was set at a < 0.05 for all measures.
Confocal Imaging and Image analysis using IMARIS (Oxford Instruments)
The 3-Dimensional stack images were captured using a 63x/1.4 NA oil immersion lens and a confocal laser scanning microscope (LeicaTC S SP5 II) in 1024×1024 pixel format. Single images, corresponding to physical thickness of 1,208 μm were used for anatomical analysis and the synapse counting procedures. The z-stack images were used for the reconstruction of the synapse with IMARIS. Using spinal cord sections of Rosa.lsl.tdTomato transgenic mice incubated with antibodies against dsRed and CART the colocalization of the CART peptide in C bouton synapses was visualized. First, confocal images were deconvolved using LAS AF (Leica Microsystems – Blind Deconvolution option) in order to reduce out of focus fluorescence and improve contrast allowing for the accurate reconstruction of < 1 μm structures. Using the surface rendering module of IMARIS, two different volumes were created (3D surfaces) based on the fluorescence intensity and size (red: C bouton synapse; green: CART peptide). The overlap of the surfaces and the enclosure of the CART peptide surface (green) in the C bouton surface (red) was visualized by rendering the synapse exterior (red surface) transparent.
Tissue preparation for electrophysiology
Experiments were performed on male and female wild type C57 Black J/6 mice from postnatal days 7-12 (n= 30). All procedures were approved by the Home Office and the University of St. Andrews Animal Care Committee. All animals were sacrificed by performing a cervical dislocation followed by rapid decapitation. Animals were eviscerated and pinned ventral side up in a dissecting chamber lined with silicone elastomer (Sylguard) filled carbogenated (95% oxygen, 5% carbon dioxide), pre-chilled (1-4 degrees Celsius) dissecting artificial cerebrospinal fluid (aCSF; in mM: 25 NaCl, 188 sucrose, 1.9 KCl, 1.2 NaH2PO4, 10 MgSO4, 1 CaCl, 26 NaHCO3, 25 D-glucose, 1.5 kynurenic acid). Spinal cords were exposed by performing a ventral laminectomy, ventral roots cut and gently lifted from the spinal column. The lumbar section of the spinal cord was then secured with the ventral surface facing out to an agar block with surgical glue (Vetbond). The agar block was secured to the base of the slicing chamber with super glue. Slices from rostral (L1-L3) or caudal (L4-L6) segments were obtained on different days by placing the rostral or caudal segments facing up. The slicing chamber was filled with pre-chilled (1 - 4 degrees Celsius) carbogenated dissecting aCSF and 300 μm transverse slices made with a cutting speed of 100 μm/s on a Leica Vibratome (Leica, CT1200). Slices were transferred to a recovery chamber filled with carbogenated pre-warmed (35 degrees Celsius) recovery aCSF (in mM: 119 NaCl, 1.9 KCl, 1.2 NaH2PO4, 10 MgSO4, 1 CaCl, 26 NaHCO3, 20 glucose, 1.5 kynurenic acid, 3% dextran) for thirty minutes after completion of the last slice. Following recovery, slices were transferred to a chamber filled with carbogenated warm (35 degrees Celsius) recording aCSF (in mM: 127 NaCl, 3 KCl, 1.25 NaH2PO4, 1 MgCl, 2 CaCl2, 26 NaHCO3, 10 glucose) which was then allowed to equilibrate at room temperature (23-25 degrees Celsius) for at least one hour before experiments were initiated.
Whole cell patch clamp electrophysiology
Whole cell patch clamp recordings were obtained from motor neurons of rostral and caudal lumbar segments. Slices were stabilized in a recording chamber with fine fibers secured to a platinum harp and visualized on an Olympus BX51WI microscope under a 40x objective with infrared illumination and differential interference (DIC) contrast. Whole cell recordings were obtained under DIC illumination with pipettes (L: 100 mm, OD: 1.5 mm, ID: 0.84 mm; World Precision Instruments) pulled on a Flaming Brown micropipette puller (Sutter instruments P97) to a resistance of 3-4 MOhms. Pipettes were back-filled with intracellular solution (in mM: 140 KMeSO4, 10 NaCl, 1 CaCl2, 10 HEPES, 1 EGTA, 3 Mg-ATP and 0.4 GTP-Na2; pH 7.2-7.3, adjusted with KOH), attached to an electrode holder and preamplifier (Molecular Devices CV-7B), which were positioned with a Patch Star micromanipulator (Scientifica, UK). Signals were amplified and filtered (6 kHz low pass Bessel filter) with a Multiclamp 700 B amplifier, acquired at 20 kHz using a Digidata 1440A digitizer with pClamp Version 10.7 software (Molecular Devices) and stored on a computer for offline analysis. Current clamp recordings were whole-cell capacitance compensated using Multiclamp Commander software.
Motor neurons were identified based on location in the ventrolateral region with somata greater than 20 μm. Intrinsic properties were only measured if cells had an initial resting membrane potential below -50 mV or if access resistance was less than 20 MΩ. All recordings were performed on cells in spinal cord slices that were naive to drug treatment with no more than one cell studied per slice. Cells were excluded from analysis if access resistance changed by more than 20% of the initial value or if action potential amplitude was less than 60 mV measured from threshold. Motor neuron intrinsic properties were studied by applying a bias current to maintain the membrane potential at -60mV. All values reported are not liquid junction potential corrected to facilitate comparisons with previously published data.
Identification of fast and slow motor neuron types
Fast and slow motor neurons were identified as by 27,71 based on the onset latency at repetitive firing threshold using a 5 second square depolarizing current at rheobase. Using this approach, we were able to identify 2 repetitive firing profiles - a delayed repetitive firing with accelerating spike frequency characteristic of fast-type motor neurons and an immediate firing profile characteristic of slow type motor neurons 27,28,71.
Pharmacology
The cocaine and amphetamine regulated transcript peptide (CART acetate salt; 48 Amino Acid sequence: IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL; with triple disulfide bonds at Cys14 - Cys32, Cys20 - Cys40, Cys34 - Cys47; Lot No. P170320-MJ470307; MW = 5259.1 g/mol; Cat no.: 470307; Biomatik) and muscarine (Sigma-Aldrich) were dissolved in H2O and stored at -20 degrees Celsius until required for experiments. A working concentration of 1 μM CART and 10 μM muscarine were used for in vitro experiments.
Assessment of recruitment properties
Recruitment properties of motor neurons subtypes were assessed during slow (100 pA/s) depolarizing current ramps which allowed us to measure the recruitment current and voltage threshold of the first action potential. The voltage threshold was defined when the change in voltage reached 10 mV/s. Firing rates were compared at three points on the frequency-current curve: at recruitment (minimum firing rate), 2 times recruitment current, and maximum firing rates.
Assessment of single action potential (spike) properties
Single spike properties (spike threshold, amplitude, rise time, half width) and AHP properties (amplitude and half width) were assessed with a 10 ms square pulse applied at an intensity 25% above rheobase. Spike threshold was determined as the potential at which the derivative (dV/dt) increased above 10 mV/s. Spike amplitude, rise time, and half width were measured from this point. AHP properties (amplitude and half width) were measured from baseline (−60 mV). Single spike and AHP properties were measured using event detection features in Clampfit.
Electrophysiology statistical analysis
Mixed-effects ANOVA were conducted to test the effect of pharmacological agents on intrinsic properties with a Geisser-Greenhouse’s correction factor. Bonferroni post hoc analysis was performed when significant main effects were detected with a significance level of p < 0.05. Data are presented in figures as individual data points for all cells. Statistical analyses were performed using Graph Pad Version 9.0.0 (GraphPad Prism version 9.0.0 for Windows, GraphPad Software, San Diego, California USA, www.graphpad.com).
Hanging wire behavioral test and data analysis
The hanging wire test (reaches method) was used to assess muscle strength and coordination as was adapted from the Treat-NMD Neuromuscular Network standard operating protocol (Van Putten, 2011 DMD_M.2.1.004). Each mouse was handled by the experimenter for five consecutive days before the behavioral task. Mice were moved to the testing room 20-30 min prior to testing. All procedures and testing took place between 13:00-17:00 p.m. in an isolated testing room. A non-bending metallic wire (55cm long, 2.5mm thick) was attached to two transparent Plexiglas surfaces (40cm high) at a height approximately 35cm above soft bedding needed to break possible falls of the mouse. Each mouse handled by the tail by the experimenter was placed to the middle of the wire until it grasped it with all four limbs. For a period of 180sec the experimenter measured how many times the mouse would reach the one or the other end of the wire. Each time the mouse reached the end of the wire (1cm or less from the Plexiglas surface) the timer was stopped and the experimenter positioned the mouse at the middle of the wire hanging with all four limbs and facing the opposite Plexiglas surface. The timer would start again at this point. The number of reaches for each mouse during a three minutes period was used for statistical analysis. Statistical analyses were performed using SPSS Version 22 (SPSS Inc, Chicago, IL, USA). The groups were compared using the independent samples t-test. Data from male and female mice were combined when there were no significant differences between them, or reported separately when they differed significantly. Four to six months old mice were used. Data are presented as mean values (±SEM). Statistical significance was set at a < 0.05 for all measures.
Author contributions
L.Z., G.B.M., P.E.E., S.A.S. and K.P. were involved in conceptualization. L.Z., P.E.E., P.E.A., E.T. and M.M. performed and analyzed anatomy and imaging experiments. S.A.S. performed and analyzed electrophysiology experiments. K.P. performed and analyzed behavioral experiments. L.Z., G.B.M., P.E.E, S.A.S and K.P wrote the manuscript, which was edited by all the authors. L.Z and G.B.M. supervised the project.
Declaration of interests
The authors declare no competing interests.
Data availability
The data that support the findings of this study are available from the corresponding author upon reasonable request.
Acknowledgments
We would like to acknowledge the following people for their contributions to this manuscript: Dr. Niels Wierup for kindly providing us with the CARTKO/KO mouse line, Eirini Eleftheriadi for helping with the graphic design in illustrations of the figures, Despoina Bosveli for further analyzing part of the anatomy data, Dr. Nikolaos Kostomitsopoulos for advice and support at the BRFAA mouse facility and Dr. David L. McLean, Dr. Katharina Quinlan and Dr. Stamatis N. Pagakis for critically reading the manuscript. We would also like to thank BRFAA Imaging Unit personnel for support on imaging.
This work was supported by Greek national funds (ARISTEIA II 4257, LZ), Fondation SANTE (LZ), a Marie Curie Re-Integration Grant (268323, LZ) and by a St Andrews Restarting Research Fund (GBM and SAS). SAS was funded by a Royal Society Newton International Fellowship (NIF/R1/180091) and a Natural Sciences and Engineering Research Council of Canada (NSERC) Postdoctoral Fellowship (NSERC-PDF-517295-2018) and MM by the National Scholarship Foundation (IKY).